PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG133800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 626aa    MW: 71297 Da    PI: 6.8338
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG133800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS374.11.8e-1142516221374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l+ lL++cA+a+  ++l  a +lL++++++asp+gd+ qRla yf+++L+arla+++ ++y++l  ++t+    ++ l+a++lf+ ++P+
  Pavir.1KG133800.1.p 251 LRALLIQCAQAIVVNNLPFAGELLKKIRQHASPYGDSSQRLALYFANGLEARLAGTGFKMYQKLMEKRTR---ATDMLKAYRLFVAACPF 337
                          5789*********************************************************999999998...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          +k+++   Nq+I + +++  +vHiiDf+i++G+QWp+L++ +a+R++gpp+lRiTg+g p++g     ++ +tg+rLa++A+ ++vpf++
  Pavir.1KG133800.1.p 338 PKVAYYFSNQTIADVLNRRPKVHIIDFGITMGFQWPSLIKRFAKREGGPPKLRITGIGVPQPGfrPCAMIDATGKRLAEYAKMFNVPFQY 427
                          **************************************************************999999********************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +  +a+r+e++ +e+L+++++E+l+Vn+++q ++l de+ +++s+rd+vL+++k+++P+v+++   +  +ns+ Fl rf e l +ys+lf
  Pavir.1KG133800.1.p 428 QG-IASRWENICIEDLNIDKDEVLIVNCMYQTKYLGDETEDIDSARDRVLRIMKKINPEVLILGMINGFYNSPFFLPRFREVLFHYSSLF 516
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d++++++++++e+ri +Er llg +i nvvacegaer+er et+++W++r  +aGFk++p+++ + k      +k + d + ++e++g+l
  Pavir.1KG133800.1.p 517 DMYNTTVAENDEARILIERDLLGTDILNVVACEGAERIERPETYKQWKARSLKAGFKQLPVNQAILKRSIDEKKKNYHDDFVINEDNGWL 606
                          *****************************************************************998877777777788********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          v+gWk+r +++vS+W+
  Pavir.1KG133800.1.p 607 VQGWKGRIMYAVSSWK 622
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.078225602IPR005202Transcription factor GRAS
PfamPF035146.1E-112251622IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MESPEYCEIN SNMTLDYINR LLMEDTDERA SIYQQHDALQ ATEKPFYDIL GQAYPSSSPK  60
ETMIHTYSHI DCPQDSSNSY TEREGSGSFA SDILGPQGTQ LVANDWVSEC DRLSSQFQRG  120
AEEANKLVPS IEKLVVDLDS NGHSDYNQMI GAATGQKIKH VNKIWNHPHA DLELSEARNS  180
KHLAISASET IRDETFDSVL LCDWEVHSDA AYLREMKVKE ASNSRQNVQS KEYGQGQVKS  240
RGKKKEEGID LRALLIQCAQ AIVVNNLPFA GELLKKIRQH ASPYGDSSQR LALYFANGLE  300
ARLAGTGFKM YQKLMEKRTR ATDMLKAYRL FVAACPFPKV AYYFSNQTIA DVLNRRPKVH  360
IIDFGITMGF QWPSLIKRFA KREGGPPKLR ITGIGVPQPG FRPCAMIDAT GKRLAEYAKM  420
FNVPFQYQGI ASRWENICIE DLNIDKDEVL IVNCMYQTKY LGDETEDIDS ARDRVLRIMK  480
KINPEVLILG MINGFYNSPF FLPRFREVLF HYSSLFDMYN TTVAENDEAR ILIERDLLGT  540
DILNVVACEG AERIERPETY KQWKARSLKA GFKQLPVNQA ILKRSIDEKK KNYHDDFVIN  600
EDNGWLVQGW KGRIMYAVSS WKPKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-522556228375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008648647.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A096RDF20.0A0A096RDF2_MAIZE; Uncharacterized protein
STRINGGRMZM2G089636_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-163GRAS family protein